PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g063100.2
Common NameMTR_4g063100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 190aa    MW: 21945.9 Da    PI: 4.4931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g063100.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.3e-16243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T++E+ l  +++ ++G++ W++Iar+++ gRt++++k++w++++
  Medtr4g063100.2  2 TPQEERLVMELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.97E-11143No hitNo description
SMARTSM007179.7E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129424.799147IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-20244IPR009057Homeodomain-like
SuperFamilySSF466892.34E-12248IPR009057Homeodomain-like
PfamPF002492.9E-14242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MTPQEERLVM ELHSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKRAQE KKHATPSISS  60
SPDQSSSCQS SHFSNSNHGV DSHASNKESE EENYQVQEIE QGYSMDDIWK DIAMSEDDIN  120
VLQPDFDGTS EENSNNLSCP IMPSTSSWDY SYLDPLWVMD EEESKMLFPP IGDQYFSFYD  180
QQGNTFLTG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.111830.0leaf| root| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1392880.0BT139288.1 Medicago truncatula clone JCVI-FLMt-11A19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003606617.11e-141myb transcription factor
SwissprotQ4JL846e-39MYB59_ARATH; Transcription factor MYB59
TrEMBLG7JTP51e-141G7JTP5_MEDTR; Myb transcription factor
STRINGGLYMA15G04620.17e-58(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-39myb domain protein 48
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]